PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf04907g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ARF
Protein Properties Length: 685aa    MW: 77549.8 Da    PI: 5.1855
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf04907g00001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B347.72.8e-15125234197
                               EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS....-EEEEEE........EEETTEEEE-TTHHHHH CS
                        B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesg....rsWevkliy......rkksgryvltkGWkeFv 69 
                               f+kvlt sd+ ++  l++p k a ++      + +k+ + +l+++d+sg     s+++++i        ++++r++lt+GW+ Fv
  Niben101Scf04907g00001.1 125 FCKVLTASDTKSNWGLSIPQKDAVKCfplldmSRDKPIQ-ELVVKDLSGkdgaLSMSLEVIPfpnstiVGHPRRHLLTNGWSAFV 208
                               99****************************995555564.9********6666444444433777778999************** PP

                               HHHT--TT-EEEEEE-SSSEE..EEEEE CS
                        B3  70 kangLkegDfvvFkldgrsefelvvkvf 97 
                               ++++L +gD vvF   +++++  +v+++
  Niben101Scf04907g00001.1 209 NSKKLVSGDLVVFL--REEKGDVYVGFR 234
                               **************..457777788765 PP

2Auxin_resp28.95.1e-11261311254
                Auxin_resp   2 ahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafeteds 54 
                               ++a+ ++ +F+v+ +P++  s+F+++++k+++a+++ + v m fkm  e  +s
  Niben101Scf04907g00001.1 261 SDALPSQRPFSVYCKPQT--SQFIISLNKYLEAINRGLGVSMTFKMPSEVANS 311
                               5678899*********95..9*************************9998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.27E-20116244IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-27118245IPR015300DNA-binding pseudobarrel domain
CDDcd100172.80E-13123231No hitNo description
PROSITE profilePS508639.516125237IPR003340B3 DNA binding domain
PfamPF023625.9E-12125234IPR003340B3 DNA binding domain
SMARTSM010194.2E-4125237IPR003340B3 DNA binding domain
PfamPF065071.7E-8260311IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    Send to blast
MWSSHPKKQN HVTCKGDDDL YRELWKAFAG QFMDVPRVGE QVYYFPGLHI KQLEQSSNQE  60
LNQGTPISDP YLKILCHVVH VRFLVENISE EVYAEINLLP KHDQTEPVNP DFYHSEFPRP  120
QIHSFCKVLT ASDTKSNWGL SIPQKDAVKC FPLLDMSRDK PIQELVVKDL SGKDGALSMS  180
LEVIPFPNST IVGHPRRHLL TNGWSAFVNS KKLVSGDLVV FLREEKGDVY VGFRHLLCEK  240
SSVEAPVASS LDIKGVLAVA SDALPSQRPF SVYCKPQTSQ FIISLNKYLE AINRGLGVSM  300
TFKMPSEVAN SHGSFTCMTN EKDQMQINQY SQNANVFPNK DEEYMEDAEA IVYSPPQHNM  360
TPLEIGEKRH SDHAICISPV EGNVESTYED STRKHNEVSN PVEIESIRGT EEPKAITSSS  420
WNFNPIQEEE LEDAEIIKDI LPIVSQNLPL DYTVSSNMDN DHFLPIVQDF EEWQNFQGTD  480
FPLHVQSPSG NHNMQNFSNK DQQNSSKAMH PTSISSQIPY DGPGHADEKV QWEGYHVARR  540
YIPILNRIIS QYPSSLSSFK ATSPIFQSMC LEILAELVYL LGQFTTANMD IKYLSEAKRY  600
LGDLKLSGIE IGWLGKRLAK VEDIFTMKRI SIRRQELILG IEDTRGTLRL MNEELGSLEK  660
ELQKLSTNIN LKTPAEDQPI LEGLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A6e-721830417296Auxin response factor 1
4ldw_A6e-721830417296Auxin response factor 1
4ldw_B6e-721830417296Auxin response factor 1
4ldx_A8e-721830417296Auxin response factor 1
4ldx_B8e-721830417296Auxin response factor 1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009773406.10.0PREDICTED: uncharacterized protein LOC104223639 isoform X1
RefseqXP_016513811.10.0PREDICTED: uncharacterized protein LOC107830695 isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1534468
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46530.12e-76auxin response factor 11